Lineage for d4za0b1 (4za0 B:1-140)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191245Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2191296Protein Enolase [54828] (10 species)
  7. 2191340Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
    Uniprot P09104
  8. 2191370Domain d4za0b1: 4za0 B:1-140 [316518]
    Other proteins in same PDB: d4za0a2, d4za0b2
    automated match to d2akza2
    complexed with mg, pah

Details for d4za0b1

PDB Entry: 4za0 (more details), 2.31 Å

PDB Description: structure of human enolase 2 in complex with phosphonoacetohydroxamate
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d4za0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4za0b1 d.54.1.1 (B:1-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
agaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d4za0b1:

Click to download the PDB-style file with coordinates for d4za0b1.
(The format of our PDB-style files is described here.)

Timeline for d4za0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4za0b2