![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
![]() | Domain d5c7jc1: 5c7j C:2-73 [316516] Other proteins in same PDB: d5c7ja_, d5c7jb_, d5c7jc2, d5c7jd2 automated match to d4bbnf_ |
PDB Entry: 5c7j (more details), 3 Å
SCOPe Domain Sequences for d5c7jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c7jc1 d.15.1.1 (C:2-73) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} qifvktlagwgitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyni rydsqlhlvgrl
Timeline for d5c7jc1:
![]() Domains from other chains: (mouse over for more information) d5c7ja_, d5c7jb_, d5c7jd1, d5c7jd2 |