| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.4: T-box [81316] (3 proteins) automatically mapped to Pfam PF00907 |
| Protein automated matches [191154] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189324] (4 PDB entries) |
| Domain d5bqda_: 5bqd A: [316511] automated match to d5bqdb_ complexed with mg |
PDB Entry: 5bqd (more details), 2.58 Å
SCOPe Domain Sequences for d5bqda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bqda_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skspsspqaaftqqgmegikvflherelwlkfhevgtemiitkagrrmfpsykvkvtgln
pktkyillmdivpaddhrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsf
qklkltnnhldpfghiilnsmhkyqprlhivkadenngfgskntafcthvfpetafiavt
syqnhkitqlkiennpf
Timeline for d5bqda_: