Lineage for d5b0ze_ (5b0z E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698749Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)
  8. 2698769Domain d5b0ze_: 5b0z E: [316507]
    Other proteins in same PDB: d5b0zb_, d5b0zf_
    automated match to d1eqzg_
    complexed with cl, mn

Details for d5b0ze_

PDB Entry: 5b0z (more details), 1.99 Å

PDB Description: the crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d5b0ze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b0ze_ a.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvglfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d5b0ze_:

Click to download the PDB-style file with coordinates for d5b0ze_.
(The format of our PDB-style files is described here.)

Timeline for d5b0ze_: