Lineage for d4z4la1 (4z4l A:1-390)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722319Species Caldicellulosiruptor saccharolyticus [TaxId:351627] [315551] (3 PDB entries)
  8. 2722321Domain d4z4la1: 4z4l A:1-390 [316504]
    Other proteins in same PDB: d4z4la2
    automated match to d3wkga_
    complexed with edo

Details for d4z4la1

PDB Entry: 4z4l (more details), 1.67 Å

PDB Description: crystal structure of cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus dsm 8903
PDB Compounds: (A:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d4z4la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z4la1 a.102.1.0 (A:1-390) automated matches {Caldicellulosiruptor saccharolyticus [TaxId: 351627]}
mditmfkedlkshleekiipfwqslkddefggyygymdfnlnidrkaqkgcvlnsrilwf
fsacynvlksekckemafhafeflknkfwdkeyeglfwsvshkgvpvdvtkhvyvqafgi
yglseyyeasgdeealhmakrlfeiletkckrengyteqfernwqekenrflsengvias
ktmnthlhvlesytnlyrllklddvyealewivrlfvdkiykkgtghfkvlcddnwneli
kavsyghdieaswlldqaakylkdeklkeeveklalevaqitlkeafdgqslinemiedr
idrskiwwveaetvvgffnayqktkeeiyldaaiktwefikehlvdrrknsewlwkvned
leavnmpiveqwkcpyhngrmcleiikrvd

SCOPe Domain Coordinates for d4z4la1:

Click to download the PDB-style file with coordinates for d4z4la1.
(The format of our PDB-style files is described here.)

Timeline for d4z4la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z4la2