SCOPe 2.08: Domain d5aeab1: 5aea B:1-97

Lineage for d5aeab1 (5aea B:1-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d5aeab1: 5aea B:1-97 [316502]
   Other proteins in same PDB: d5aeaa2, d5aeab2
   automated match to d2ncma_
   complexed with flc

Details for d5aeab1

PDB Entry: 5aea, 1.9 Å

PDB Description: crystal structure of human ncam domain 1

PDB Compounds: (B:) Neural cell adhesion molecule 1

SCOPe Domain Sequences for d5aeab1:

Sequence, based on SEQRES records:

>d5aeab1 b.1.1.4 (B:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngekltpnqqrisvvwnddsss
tltiynaniddagiykcvvtgedgseseatvnvkifq

Sequence, based on observed residues (ATOM records):

>d5aeab1 b.1.1.4 (B:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngekltpnqqrisvvwnddsss
tltiynaniddagiykcvvtgedseseatvnvkifq

Timeline for d5aeab1:

• d5aeab1 first appeared in SCOPe 2.06
  
• d5aeab1 appears in SCOPe 2.07