SCOPe 2.08: Domain d4ysnc1: 4ysn C:1-441

Lineage for d4ysnc1 (4ysn C:1-441)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Lactobacillus buchneri [TaxId:1581] [316142] (5 PDB entries)

8. Domain d4ysnc1: 4ysn C:1-441 [316494]
   Other proteins in same PDB: d4ysna2, d4ysnb2, d4ysnc2, d4ysnd2
   automated match to d3oksa_
   complexed with plp

Details for d4ysnc1

PDB Entry: 4ysn, 1.94 Å

PDB Description: structure of aminoacid racemase in complex with plp

PDB Compounds: (C:) Putative 4-aminobutyrate aminotransferase

SCOPe Domain Sequences for d4ysnc1:

Sequence; same for both SEQRES and ATOM records:

>d4ysnc1 c.67.1.0 (C:1-441) automated matches {Lactobacillus buchneri [TaxId: 1581]}
mgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasainvg
hthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgnsgsdand
aiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhvpypdsyr
typgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeymqlvykfc
hehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavigkkevmqs
ldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqrhpmigdv
rmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqpplvipreql
dqalqvlddaftavengevti

Timeline for d4ysnc1:

• d4ysnc1 first appeared in SCOPe 2.06
  
• d4ysnc1 appears in SCOPe 2.07