![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Lactobacillus buchneri [TaxId:1581] [316142] (5 PDB entries) |
![]() | Domain d4ysnc1: 4ysn C:1-441 [316494] Other proteins in same PDB: d4ysna2, d4ysnb2, d4ysnc2, d4ysnd2 automated match to d3oksa_ complexed with plp |
PDB Entry: 4ysn (more details), 1.94 Å
SCOPe Domain Sequences for d4ysnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ysnc1 c.67.1.0 (C:1-441) automated matches {Lactobacillus buchneri [TaxId: 1581]} mgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasainvg hthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgnsgsdand aiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhvpypdsyr typgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeymqlvykfc hehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavigkkevmqs ldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqrhpmigdv rmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqpplvipreql dqalqvlddaftavengevti
Timeline for d4ysnc1: