SCOPe 2.06: Domain d4zwna1: 4zwn A:2-310

Lineage for d4zwna1 (4zwn A:2-310)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [316344] (2 PDB entries)

8. Domain d4zwna1: 4zwn A:2-310 [316479]
   Other proteins in same PDB: d4zwna2, d4zwnb2, d4zwnc2, d4zwnd2
   automated match to d3hjub_
   complexed with na, no3, so4

Details for d4zwna1

PDB Entry: 4zwn, 2.49 Å

PDB Description: crystal structure of a soluble variant of the monoglyceride lipase from saccharomyces cerevisiae

PDB Compounds: (A:) Monoglyceride lipase

SCOPe Domain Sequences for d4zwna1:

Sequence; same for both SEQRES and ATOM records:

>d4zwna1 c.69.1.0 (A:2-310) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
apypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlmd
hlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmwg
hsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvrid
tgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdk
pviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkq
wldkhttte

Timeline for d4zwna1:

• d4zwna1 is new in SCOPe 2.06-stable
  
• d4zwna1 appears in SCOPe 2.07
  
• d4zwna1 appears in the current release, SCOPe 2.08