Lineage for d4zwna1 (4zwn A:2-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2901997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [316344] (2 PDB entries)
  8. 2901998Domain d4zwna1: 4zwn A:2-310 [316479]
    Other proteins in same PDB: d4zwna2, d4zwnb2, d4zwnc2, d4zwnd2
    automated match to d3hjub_
    complexed with na, no3, so4

Details for d4zwna1

PDB Entry: 4zwn (more details), 2.49 Å

PDB Description: crystal structure of a soluble variant of the monoglyceride lipase from saccharomyces cerevisiae
PDB Compounds: (A:) Monoglyceride lipase

SCOPe Domain Sequences for d4zwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zwna1 c.69.1.0 (A:2-310) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
apypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlmd
hlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmwg
hsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvrid
tgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakdk
pviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmkq
wldkhttte

SCOPe Domain Coordinates for d4zwna1:

Click to download the PDB-style file with coordinates for d4zwna1.
(The format of our PDB-style files is described here.)

Timeline for d4zwna1: