![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
![]() | Protein automated matches [190108] (23 species) not a true protein |
![]() | Species Caldicellulosiruptor saccharolyticus [TaxId:351627] [315551] (3 PDB entries) |
![]() | Domain d4z4ja1: 4z4j A:1-390 [316471] Other proteins in same PDB: d4z4ja2 automated match to d3wkga_ complexed with edo, ipa |
PDB Entry: 4z4j (more details), 1.54 Å
SCOPe Domain Sequences for d4z4ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z4ja1 a.102.1.0 (A:1-390) automated matches {Caldicellulosiruptor saccharolyticus [TaxId: 351627]} mditrfkedlkahleekiipfwqslkddefggyygymdfnlnidrkaqkgcilnsrilwf fsacynvlksekckemafhafeflknkfwdkeyeglfwsvshkgvpvdvtkhvyvqafgi yglseyyeasgdeealhmakrlfeiletkckrengyteqfernwqekenrflsengvias ktmnthlhvlesytnlyrllklddvyealewivrlfvdkiykkgtghfkvfcddnwneli kavsyghdieaswlldqaakylkdeklkeeveklalevaqitlkeafdgqslinemiedr idrskiwwveaetvvgffnayqktkeekyldaaiktwefikehlvdrrknsewlwkvned leavnmpiveqwkcpyhngrmcleiikrvd
Timeline for d4z4ja1: