SCOP 1.65: Domain d1gsoa2: 1gso A:-2-103

Lineage for d1gsoa2 (1gso A:-2-103)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (5 families)
   preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)

6. Protein Glycinamide ribonucleotide synthetase (GAR-syn), N-domain [52444] (1 species)

7. Species Escherichia coli [TaxId:562] [52445] (1 PDB entry)

8. Domain d1gsoa2: 1gso A:-2-103 [31647]
   Other proteins in same PDB: d1gsoa1, d1gsoa3
   mutant

Details for d1gsoa2

PDB Entry: 1gso, 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.

SCOP Domain Sequences for d1gsoa2:

Sequence; same for both SEQRES and ATOM records:

>d1gsoa2 c.30.1.1 (A:-2-103) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Escherichia coli}
efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld
faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqleg

Timeline for d1gsoa2:

• d1gsoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsoa2 appears in SCOP 1.63
  
• d1gsoa2 appears in SCOP 1.67
  
• d1gsoa2 appears in the current release, SCOPe 2.08