SCOP 1.61: Domain d1gsoa2: 1gso A:-2-103

Lineage for d1gsoa2 (1gso A:-2-103)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Glycinamide ribonucleotide synthetase (GAR-syn). [52444] (1 species)

7. Species Escherichia coli [TaxId:562] [52445] (1 PDB entry)

8. Domain d1gsoa2: 1gso A:-2-103 [31647]
   Other proteins in same PDB: d1gsoa1, d1gsoa3

Details for d1gsoa2

PDB Entry: 1gso, 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.

SCOP Domain Sequences for d1gsoa2:

Sequence; same for both SEQRES and ATOM records:

>d1gsoa2 c.30.1.1 (A:-2-103) Glycinamide ribonucleotide synthetase (GAR-syn). {Escherichia coli}
efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld
faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqleg

Timeline for d1gsoa2:

• d1gsoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsoa2 appears in SCOP 1.59
  
• d1gsoa2 appears in SCOP 1.63
  
• d1gsoa2 appears in the current release, SCOPe 2.08