Lineage for d1gsoa2 (1gso A:-2-103)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69114Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 69115Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 69116Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 69183Protein Glycinamide ribonucleotide synthetase (GAR-syn). [52444] (1 species)
  7. 69184Species Escherichia coli [TaxId:562] [52445] (1 PDB entry)
  8. 69185Domain d1gsoa2: 1gso A:-2-103 [31647]
    Other proteins in same PDB: d1gsoa1, d1gsoa3

Details for d1gsoa2

PDB Entry: 1gso (more details), 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.

SCOP Domain Sequences for d1gsoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsoa2 c.30.1.1 (A:-2-103) Glycinamide ribonucleotide synthetase (GAR-syn). {Escherichia coli}
efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld
faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqleg

SCOP Domain Coordinates for d1gsoa2:

Click to download the PDB-style file with coordinates for d1gsoa2.
(The format of our PDB-style files is described here.)

Timeline for d1gsoa2: