Lineage for d4yz3a1 (4yz3 A:84-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781348Species Streptococcus pneumoniae [TaxId:170187] [277427] (2 PDB entries)
  8. 2781351Domain d4yz3a1: 4yz3 A:84-273 [316464]
    Other proteins in same PDB: d4yz3a2, d4yz3b2, d4yz3b3
    automated match to d4yz2a1
    complexed with g39, so4

Details for d4yz3a1

PDB Entry: 4yz3 (more details), 2.38 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, in complex with oseltamivir.
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4yz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yz3a1 b.29.1.0 (A:84-273) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
vkkmttnavt

SCOPe Domain Coordinates for d4yz3a1:

Click to download the PDB-style file with coordinates for d4yz3a1.
(The format of our PDB-style files is described here.)

Timeline for d4yz3a1: