| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:170187] [277427] (2 PDB entries) |
| Domain d4yz3a1: 4yz3 A:84-273 [316464] Other proteins in same PDB: d4yz3a2, d4yz3b2, d4yz3b3 automated match to d4yz2a1 complexed with g39, so4 |
PDB Entry: 4yz3 (more details), 2.38 Å
SCOPe Domain Sequences for d4yz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yz3a1 b.29.1.0 (A:84-273) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
vkkmttnavt
Timeline for d4yz3a1: