SCOPe 2.08: Domain d4yz3b1: 4yz3 B:84-273

Lineage for d4yz3b1 (4yz3 B:84-273)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [277427] (2 PDB entries)

8. Domain d4yz3b1: 4yz3 B:84-273 [316463]
   Other proteins in same PDB: d4yz3a2, d4yz3b2, d4yz3b3
   automated match to d4yz2a1
   complexed with g39, so4

Details for d4yz3b1

PDB Entry: 4yz3, 2.38 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, in complex with oseltamivir.

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4yz3b1:

Sequence; same for both SEQRES and ATOM records:

>d4yz3b1 b.29.1.0 (B:84-273) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
vkkmttnavt

Timeline for d4yz3b1:

• d4yz3b1 first appeared in SCOPe 2.06
  
• d4yz3b1 appears in SCOPe 2.07