Lineage for d4z3gb1 (4z3g B:0-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767730Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (2 proteins)
    automatically mapped to Pfam PF03627
  6. 2767735Protein automated matches [315530] (1 species)
    not a true protein
  7. 2767736Species Escherichia coli [TaxId:562] [315531] (6 PDB entries)
  8. 2767738Domain d4z3gb1: 4z3g B:0-196 [316462]
    Other proteins in same PDB: d4z3ga2, d4z3gb2
    automated match to d4z3jc_
    complexed with 4ks, mes

Details for d4z3gb1

PDB Entry: 4z3g (more details), 1.45 Å

PDB Description: crystal structure of the lectin domain of papg from e. coli bi47 in complex with 4-methoxyphenyl beta-d-galabiose in space group p212121
PDB Compounds: (B:) PapG, lectin domain

SCOPe Domain Sequences for d4z3gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z3gb1 b.2.3.3 (B:0-196) automated matches {Escherichia coli [TaxId: 562]}
awnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgswayyre
yiawvvfpkkvmtkngyplfievhnkgswseentgdndsyfflkgykwdqrafdtanlcq
kpgettrltekfddiifkvalpadlplgdysvtipytsgiqrhfasylgarfkipynvak
tlprenemlflfknigg

SCOPe Domain Coordinates for d4z3gb1:

Click to download the PDB-style file with coordinates for d4z3gb1.
(The format of our PDB-style files is described here.)

Timeline for d4z3gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z3gb2