Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [52443] (24 PDB entries) |
Domain d1dv2b2: 1dv2 B:1-114 [31646] Other proteins in same PDB: d1dv2a1, d1dv2a3, d1dv2a4, d1dv2b1, d1dv2b3, d1dv2b4 complexed with atp; mutant |
PDB Entry: 1dv2 (more details), 2.5 Å
SCOPe Domain Sequences for d1dv2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv2b2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d1dv2b2:
View in 3D Domains from other chains: (mouse over for more information) d1dv2a1, d1dv2a2, d1dv2a3, d1dv2a4 |