SCOPe 2.08: Domain d1dv2b2: 1dv2 B:1-114

Lineage for d1dv2b2 (1dv2 B:1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)

8. Domain d1dv2b2: 1dv2 B:1-114 [31646]
   Other proteins in same PDB: d1dv2a1, d1dv2a3, d1dv2a4, d1dv2b1, d1dv2b3, d1dv2b4
   complexed with atp; mutant

Details for d1dv2b2

PDB Entry: 1dv2, 2.5 Å

PDB Description: the structure of biotin carboxylase, mutant e288k, complexed with atp

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d1dv2b2:

Sequence; same for both SEQRES and ATOM records:

>d1dv2b2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d1dv2b2:

• d1dv2b2 first appeared (with stable ids) in SCOP 1.55
  
• d1dv2b2 appears in SCOPe 2.07