SCOPe 2.06: Domain d4z07a2: 4z07 A:228-351

Lineage for d4z07a2 (4z07 A:228-351)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256346] (13 PDB entries)

8. Domain d4z07a2: 4z07 A:228-351 [316459]
   automated match to d4z07c2
   complexed with ipa, pcg, so4

Details for d4z07a2

PDB Entry: 4z07, 2.5 Å

PDB Description: co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp

PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d4z07a2:

Sequence; same for both SEQRES and ATOM records:

>d4z07a2 b.82.3.0 (A:228-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvnvtred
spsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligglddvs
nkay

Timeline for d4z07a2:

• d4z07a2 is new in SCOPe 2.06-stable
  
• d4z07a2 appears in SCOPe 2.07
  
• d4z07a2 appears in the current release, SCOPe 2.08