SCOPe 2.07: Domain d4yolb1: 4yol B:1G-138

Lineage for d4yolb1 (4yol B:1G-138)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d4yolb1: 4yol B:1G-138 [316454]
   Other proteins in same PDB: d4yola2, d4yolb2
   automated match to d3ojma_
   complexed with flc, imd

Details for d4yolb1

PDB Entry: 4yol, 1.97 Å

PDB Description: human fibroblast growth factor-1 c16s/a66c/c117a/p134a

PDB Compounds: (B:) fibroblast growth factor 1

SCOPe Domain Sequences for d4yolb1:

Sequence; same for both SEQRES and ATOM records:

>d4yolb1 b.42.1.1 (B:1G-138) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylcmdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsakrg
prthygqkailflalpvs

Timeline for d4yolb1:

• d4yolb1 first appeared in SCOPe 2.06
  
• d4yolb1 appears in the current release, SCOPe 2.08