Lineage for d4yolb1 (4yol B:1G-138)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061459Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2061460Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2061474Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2061639Domain d4yolb1: 4yol B:1G-138 [316454]
    Other proteins in same PDB: d4yola2, d4yolb2
    automated match to d3ojma_
    complexed with flc, imd

Details for d4yolb1

PDB Entry: 4yol (more details), 1.97 Å

PDB Description: human fibroblast growth factor-1 c16s/a66c/c117a/p134a
PDB Compounds: (B:) fibroblast growth factor 1

SCOPe Domain Sequences for d4yolb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yolb1 b.42.1.1 (B:1G-138) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylcmdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsakrg
prthygqkailflalpvs

SCOPe Domain Coordinates for d4yolb1:

Click to download the PDB-style file with coordinates for d4yolb1.
(The format of our PDB-style files is described here.)

Timeline for d4yolb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yolb2