SCOPe 2.08: Domain d4yagb_: 4yag B:

Lineage for d4yagb_ (4yag B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Sphingobium sp. [TaxId:627192] [311972] (5 PDB entries)

8. Domain d4yagb_: 4yag B: [316451]
   automated match to d4y9da_
   complexed with nai

Details for d4yagb_

PDB Entry: 4yag, 1.5 Å

PDB Description: crystal structure of ligl in complex with nadh from sphingobium sp. strain syk-6

PDB Compounds: (B:) C alpha-dehydrogenase

SCOPe Domain Sequences for d4yagb_:

Sequence; same for both SEQRES and ATOM records:

>d4yagb_ c.2.1.0 (B:) automated matches {Sphingobium sp. [TaxId: 627192]}
mdiagttafitggasgigfgiaqrllangarlvladirqdhldearqffeerqqgrnvht
irldvsdraqmaeaareceavmggpdilinnagidpsgpfkdatyqdwdyglainlmgpi
ngimaftpgmrargrgghivntaslagltpmpsfmaiyatakaavitltetirdsmaedn
igvtvlmpgpiksrihesgqnrperfragsglaeteqqlakrvvadnwmeptevgdmivd
aivhnklyvsthgnwretcearfqalldsmp

Timeline for d4yagb_:

• d4yagb_ first appeared in SCOPe 2.06
  
• d4yagb_ appears in SCOPe 2.07