Lineage for d4yaeb_ (4yae B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2432336Species Sphingobium sp. [TaxId:627192] [311972] (5 PDB entries)
  8. 2432342Domain d4yaeb_: 4yae B: [316448]
    automated match to d4y9da_

Details for d4yaeb_

PDB Entry: 4yae (more details), 1.6 Å

PDB Description: crystal structure of ligl-apo form from sphingobium sp. strain syk-6
PDB Compounds: (B:) C alpha-dehydrogenase

SCOPe Domain Sequences for d4yaeb_:

Sequence, based on SEQRES records: (download)

>d4yaeb_ c.2.1.0 (B:) automated matches {Sphingobium sp. [TaxId: 627192]}
mdiagttafitggasgigfgiaqrllangarlvladirqdhldearqffeerqqgrnvht
irldvsdraqmaeaareceavmggpdilinnagidpsgpfkdatyqdwdyglainlmgpi
ngimaftpgmrargrgghivntaslagltpmpsfmaiyatakaavitltetirdsmaedn
igvtvlmpgpiksrihesgqnrperfragsglaeteqqlakrvvadnwmeptevgdmivd
aivhnklyvsthgnwretcearfqalldsmp

Sequence, based on observed residues (ATOM records): (download)

>d4yaeb_ c.2.1.0 (B:) automated matches {Sphingobium sp. [TaxId: 627192]}
mdiagttafitggasgigfgiaqrllangarlvladirqdhldearqffeerqqgrnvht
irldvsdraqmaeaareceavmggpdilinnagidpsgpfkdatyqdwdyglainlmgpi
ngimaftpgmrargrgghivntaslagltpmpsfmaiyatakaavitltetirdsmaedn
igvtvlmpgpimeptevgdmivdaivhnklyvsthgnwretcearfqalldsmp

SCOPe Domain Coordinates for d4yaeb_:

Click to download the PDB-style file with coordinates for d4yaeb_.
(The format of our PDB-style files is described here.)

Timeline for d4yaeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4yaea_