Lineage for d4xo6a1 (4xo6 A:2-323)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2437839Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 2437840Species Human (Homo sapiens), type III [TaxId:9606] [69383] (16 PDB entries)
    bile acid binding protein
  8. 2437845Domain d4xo6a1: 4xo6 A:2-323 [316445]
    Other proteins in same PDB: d4xo6a2, d4xo6b2
    automated match to d2fgba_
    complexed with 5sd, aox, edo, gol, nap, so4

Details for d4xo6a1

PDB Entry: 4xo6 (more details), 1.2 Å

PDB Description: crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
PDB Compounds: (A:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d4xo6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xo6a1 c.1.7.1 (A:2-323) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
nvryltldifagppnypfsdey

SCOPe Domain Coordinates for d4xo6a1:

Click to download the PDB-style file with coordinates for d4xo6a1.
(The format of our PDB-style files is described here.)

Timeline for d4xo6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xo6a2