![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains) Common fold covers whole protein structure |
![]() | Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species) |
![]() | Species Human (Homo sapiens), type III [TaxId:9606] [69383] (16 PDB entries) bile acid binding protein |
![]() | Domain d4xo6a1: 4xo6 A:2-323 [316445] Other proteins in same PDB: d4xo6a2, d4xo6b2 automated match to d2fgba_ complexed with 5sd, aox, edo, gol, nap, so4 |
PDB Entry: 4xo6 (more details), 1.2 Å
SCOPe Domain Sequences for d4xo6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xo6a1 c.1.7.1 (A:2-323) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]} dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr nvryltldifagppnypfsdey
Timeline for d4xo6a1: