Lineage for d1bncb2 (1bnc B:1-114)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1161658Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1161659Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1161660Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1161667Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1161670Species Escherichia coli [TaxId:562] [52443] (7 PDB entries)
  8. 1161680Domain d1bncb2: 1bnc B:1-114 [31644]
    Other proteins in same PDB: d1bnca1, d1bnca3, d1bncb1, d1bncb3
    complexed with po4

Details for d1bncb2

PDB Entry: 1bnc (more details), 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d1bncb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bncb2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d1bncb2:

Click to download the PDB-style file with coordinates for d1bncb2.
(The format of our PDB-style files is described here.)

Timeline for d1bncb2: