SCOP 1.75: Domain d1bncb2: 1bnc B:1-114

Lineage for d1bncb2 (1bnc B:1-114)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (8 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [52443] (7 PDB entries)

8. Domain d1bncb2: 1bnc B:1-114 [31644]
   Other proteins in same PDB: d1bnca1, d1bnca3, d1bncb1, d1bncb3
   complexed with po4

Details for d1bncb2

PDB Entry: 1bnc, 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

PDB Compounds: (B:) biotin carboxylase

SCOP Domain Sequences for d1bncb2:

Sequence; same for both SEQRES and ATOM records:

>d1bncb2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d1bncb2:

• d1bncb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bncb2 appears in SCOP 1.73
  
• d1bncb2 appears in SCOPe 2.01
  
• d1bncb2 appears in the current release, SCOPe 2.08