SCOP 1.59: Domain d1bncb2: 1bnc B:1-114

Lineage for d1bncb2 (1bnc B:1-114)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase [52442] (1 species)

7. Species Escherichia coli [TaxId:562] [52443] (3 PDB entries)

8. Domain d1bncb2: 1bnc B:1-114 [31644]
   Other proteins in same PDB: d1bnca1, d1bnca3, d1bncb1, d1bncb3

Details for d1bncb2

PDB Entry: 1bnc, 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

SCOP Domain Sequences for d1bncb2:

Sequence; same for both SEQRES and ATOM records:

>d1bncb2 c.30.1.1 (B:1-114) Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase {Escherichia coli}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d1bncb2:

• d1bncb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bncb2 appears in SCOP 1.57
  
• d1bncb2 appears in SCOP 1.61
  
• d1bncb2 appears in the current release, SCOPe 2.08