![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
![]() | Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) ![]() |
![]() | Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins) |
![]() | Protein Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase [52442] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52443] (3 PDB entries) |
![]() | Domain d1bncb2: 1bnc B:1-114 [31644] Other proteins in same PDB: d1bnca1, d1bnca3, d1bncb1, d1bncb3 |
PDB Entry: 1bnc (more details), 2.4 Å
SCOP Domain Sequences for d1bncb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bncb2 c.30.1.1 (B:1-114) Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase {Escherichia coli} mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d1bncb2: