Lineage for d4uhjc1 (4uhj C:2-123)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464238Species Escherichia coli [TaxId:83333] [315489] (3 PDB entries)
  8. 2464241Domain d4uhjc1: 4uhj C:2-123 [316436]
    Other proteins in same PDB: d4uhja2, d4uhjb2, d4uhjc2
    automated match to d3gt7a_
    complexed with mg

Details for d4uhjc1

PDB Entry: 4uhj (more details), 1.9 Å

PDB Description: crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form)
PDB Compounds: (C:) transcriptional regulatory protein cpxr

SCOPe Domain Sequences for d4uhjc1:

Sequence, based on SEQRES records: (download)

>d4uhjc1 c.23.1.0 (C:2-123) automated matches {Escherichia coli [TaxId: 83333]}
nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws
eq

Sequence, based on observed residues (ATOM records): (download)

>d4uhjc1 c.23.1.0 (C:2-123) automated matches {Escherichia coli [TaxId: 83333]}
nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
tlkalrqthqtpvimltldrvlglelgaddylpkpfndrelvarirailrrshwseq

SCOPe Domain Coordinates for d4uhjc1:

Click to download the PDB-style file with coordinates for d4uhjc1.
(The format of our PDB-style files is described here.)

Timeline for d4uhjc1: