Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Escherichia coli [TaxId:83333] [315489] (3 PDB entries) |
Domain d4uhjc1: 4uhj C:2-123 [316436] Other proteins in same PDB: d4uhja2, d4uhjb2, d4uhjc2 automated match to d3gt7a_ complexed with mg |
PDB Entry: 4uhj (more details), 1.9 Å
SCOPe Domain Sequences for d4uhjc1:
Sequence, based on SEQRES records: (download)
>d4uhjc1 c.23.1.0 (C:2-123) automated matches {Escherichia coli [TaxId: 83333]} nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws eq
>d4uhjc1 c.23.1.0 (C:2-123) automated matches {Escherichia coli [TaxId: 83333]} nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid tlkalrqthqtpvimltldrvlglelgaddylpkpfndrelvarirailrrshwseq
Timeline for d4uhjc1:
View in 3D Domains from other chains: (mouse over for more information) d4uhja1, d4uhja2, d4uhjb1, d4uhjb2 |