SCOPe 2.06: Domain d4uhjc1: 4uhj C:2-123

Lineage for d4uhjc1 (4uhj C:2-123)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [315489] (3 PDB entries)

8. Domain d4uhjc1: 4uhj C:2-123 [316436]
   Other proteins in same PDB: d4uhja2, d4uhjb2, d4uhjc2
   automated match to d3gt7a_
   complexed with mg

Details for d4uhjc1

PDB Entry: 4uhj, 1.9 Å

PDB Description: crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form)

PDB Compounds: (C:) transcriptional regulatory protein cpxr

SCOPe Domain Sequences for d4uhjc1:

Sequence, based on SEQRES records:

>d4uhjc1 c.23.1.0 (C:2-123) automated matches {Escherichia coli [TaxId: 83333]}
nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws
eq

Sequence, based on observed residues (ATOM records):

>d4uhjc1 c.23.1.0 (C:2-123) automated matches {Escherichia coli [TaxId: 83333]}
nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
tlkalrqthqtpvimltldrvlglelgaddylpkpfndrelvarirailrrshwseq

Timeline for d4uhjc1:

• d4uhjc1 is new in SCOPe 2.06-stable
  
• d4uhjc1 appears in SCOPe 2.07
  
• d4uhjc1 appears in the current release, SCOPe 2.08