Lineage for d1bnca2 (1bnc A:1-114)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121291Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 121292Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 121293Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 121294Protein Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase [52442] (1 species)
  7. 121295Species Escherichia coli [TaxId:562] [52443] (3 PDB entries)
  8. 121298Domain d1bnca2: 1bnc A:1-114 [31643]
    Other proteins in same PDB: d1bnca1, d1bnca3, d1bncb1, d1bncb3

Details for d1bnca2

PDB Entry: 1bnc (more details), 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

SCOP Domain Sequences for d1bnca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnca2 c.30.1.1 (A:1-114) Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase {Escherichia coli}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOP Domain Coordinates for d1bnca2:

Click to download the PDB-style file with coordinates for d1bnca2.
(The format of our PDB-style files is described here.)

Timeline for d1bnca2: