SCOPe 2.06: Domain d2mzcb1: 2mzc B:5-92

Lineage for d2mzcb1 (2mzc B:5-92)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Brucella melitensis [TaxId:224914] [316417] (1 PDB entry)

8. Domain d2mzcb1: 2mzc B:5-92 [316420]
   Other proteins in same PDB: d2mzca2, d2mzcb2
   automated match to d1fova_
   complexed with ag

Details for d2mzcb1

PDB Entry: 2mzc

PDB Description: metal binding of glutaredoxins

PDB Compounds: (B:) glutaredoxin

SCOPe Domain Sequences for d2mzcb1:

Sequence; same for both SEQRES and ATOM records:

>d2mzcb1 c.47.1.0 (B:5-92) automated matches {Brucella melitensis [TaxId: 224914]}
mvdviiytrpgcpycarakallarkgaefneidasatpelraemqersgrntfpqifigs
vhvggsddlyaledegkldsllktgkli

Timeline for d2mzcb1:

• d2mzcb1 is new in SCOPe 2.06-stable
  
• d2mzcb1 appears in SCOPe 2.07
  
• d2mzcb1 appears in the current release, SCOPe 2.08