Lineage for d1dv1b2 (1dv1 B:1-114)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69114Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 69115Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 69116Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 69117Protein Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase [52442] (1 species)
  7. 69118Species Escherichia coli [TaxId:562] [52443] (3 PDB entries)
  8. 69120Domain d1dv1b2: 1dv1 B:1-114 [31642]
    Other proteins in same PDB: d1dv1a1, d1dv1a3, d1dv1b1, d1dv1b3

Details for d1dv1b2

PDB Entry: 1dv1 (more details), 1.9 Å

PDB Description: structure of biotin carboxylase (apo)

SCOP Domain Sequences for d1dv1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv1b2 c.30.1.1 (B:1-114) Biotin carboxylase (BC) subunit of acetyl-CoA carboxylase {Escherichia coli}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOP Domain Coordinates for d1dv1b2:

Click to download the PDB-style file with coordinates for d1dv1b2.
(The format of our PDB-style files is described here.)

Timeline for d1dv1b2: