Lineage for d2mzca1 (2mzc A:5-92)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879309Species Brucella melitensis [TaxId:224914] [316417] (1 PDB entry)
  8. 2879310Domain d2mzca1: 2mzc A:5-92 [316419]
    Other proteins in same PDB: d2mzca2, d2mzcb2
    automated match to d1fova_
    complexed with ag

Details for d2mzca1

PDB Entry: 2mzc (more details)

PDB Description: metal binding of glutaredoxins
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d2mzca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mzca1 c.47.1.0 (A:5-92) automated matches {Brucella melitensis [TaxId: 224914]}
mvdviiytrpgcpycarakallarkgaefneidasatpelraemqersgrntfpqifigs
vhvggsddlyaledegkldsllktgkli

SCOPe Domain Coordinates for d2mzca1:

Click to download the PDB-style file with coordinates for d2mzca1.
(The format of our PDB-style files is described here.)

Timeline for d2mzca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mzca2