Lineage for d2n23a1 (2n23 A:2-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803640Family b.55.1.9: TFIIH domain [110272] (3 proteins)
  6. 2803641Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)
  7. 2803642Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (9 PDB entries)
    Uniprot P32776 2-115
  8. 2803645Domain d2n23a1: 2n23 A:2-115 [316415]
    Other proteins in same PDB: d2n23a2
    automated match to d2gs0a_

Details for d2n23a1

PDB Entry: 2n23 (more details)

PDB Description: nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the n-terminal activation domain of eklf (tad1)
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d2n23a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n23a1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOPe Domain Coordinates for d2n23a1:

Click to download the PDB-style file with coordinates for d2n23a1.
(The format of our PDB-style files is described here.)

Timeline for d2n23a1: