Lineage for d5c1tb1 (5c1t B:21-176)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128447Species Entamoeba histolytica [TaxId:5759] [316221] (2 PDB entries)
  8. 2128450Domain d5c1tb1: 5c1t B:21-176 [316411]
    automated match to d2fu5d_
    complexed with gtp, mg

Details for d5c1tb1

PDB Entry: 5c1t (more details), 2.8 Å

PDB Description: crystal structure of the gtp-bound wild type ehrabx3 from entamoeba histolytica
PDB Compounds: (B:) Small GTPase EhRabX3

SCOPe Domain Sequences for d5c1tb1:

Sequence, based on SEQRES records: (download)

>d5c1tb1 c.37.1.0 (B:21-176) automated matches {Entamoeba histolytica [TaxId: 5759]}
irllvvgssgvgkttlcdcffeshqsqgeetrekhvqidndfirisisdivgkqsfyacd
npydgydailvmyditelksftdlktmwlpdiflycnidtqiiiignkkdqeidriitrk
eaeqfaqdrlcqfyeistkddscqllfdcisrdflq

Sequence, based on observed residues (ATOM records): (download)

>d5c1tb1 c.37.1.0 (B:21-176) automated matches {Entamoeba histolytica [TaxId: 5759]}
irllvvgssgvgkttlcdcffeisisdivgkqacdnpydgydailvmyditelksftdlk
tmwlpdiflycnidtqiiiignkkdqeidriitrkeaeqfaqdrlcqfyeistkddscql
lfdcisrdflq

SCOPe Domain Coordinates for d5c1tb1:

Click to download the PDB-style file with coordinates for d5c1tb1.
(The format of our PDB-style files is described here.)

Timeline for d5c1tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c1tb2