Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (5 families) preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins) |
Protein Biotin carboxylase subunit of acetyl-CoA carboxylase, (BC), N-domain [52442] (1 species) |
Species Escherichia coli [TaxId:562] [52443] (3 PDB entries) |
Domain d1dv1a2: 1dv1 A:1-114 [31641] Other proteins in same PDB: d1dv1a1, d1dv1a3, d1dv1b1, d1dv1b3 |
PDB Entry: 1dv1 (more details), 1.9 Å
SCOP Domain Sequences for d1dv1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv1a2 c.30.1.1 (A:1-114) Biotin carboxylase subunit of acetyl-CoA carboxylase, (BC), N-domain {Escherichia coli} mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d1dv1a2: