SCOPe 2.06: Domain d5etha_: 5eth A:

Lineage for d5etha_ (5eth A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries)

8. Domain d5etha_: 5eth A: [316408]
   automated match to d4zoma_
   complexed with 5rt

Details for d5etha_

PDB Entry: 5eth, 2.8 Å

PDB Description: rory in complex with inverse agonist 3.

PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5etha_:

Sequence; same for both SEQRES and ATOM records:

>d5etha_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlteai
qyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmelf
ralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynlel
afhhhlckthrqsilaklppkgklrslcsqhverlqif

Timeline for d5etha_:

• d5etha_ is new in SCOPe 2.06-stable
  
• d5etha_ appears in SCOPe 2.07
  
• d5etha_ appears in the current release, SCOPe 2.08