Lineage for d5e9ga_ (5e9g A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2423593Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2423788Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 protein domains)
    forms a swapped dimer
  6. 2423851Protein automated matches [190974] (5 species)
    not a true protein
  7. 2423876Species Magnaporthe oryzae [TaxId:242507] [316238] (2 PDB entries)
  8. 2423877Domain d5e9ga_: 5e9g A: [316400]
    automated match to d1dqua_
    complexed with glv, gol, mg

Details for d5e9ga_

PDB Entry: 5e9g (more details), 2.1 Å

PDB Description: structural insights of isocitrate lyases from magnaporthe oryzae
PDB Compounds: (A:) isocitrate lyase

SCOPe Domain Sequences for d5e9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e9ga_ c.1.12.7 (A:) automated matches {Magnaporthe oryzae [TaxId: 242507]}
nmvnpavepsmeddlfarevaevkqwwsdprwrytkrpftaeqivskrgnlkieypsnaq
skklwkilegrfqkrdasytygcleptmvtqmakyldtvyvsgwqssstasssdepgpdl
adypyttvpnkvshlfmaqlfhdrkqrherlsapksersklqnidylrpiiadadtghgg
ltavmkltklfiekgaagihiedqapgtkkcghmggkvlvpisehinrlvairaqadimg
vdllaiartdaeaatlittsidprdhafilgctnpslqpladlmntaeqsgktgdqlqai
edewmakanlkrfddavvdvinssssirnpkdvaakylqaakgksnrearaiasslgvpe
iffdwdsprtregyfrikggcdcainraiayapyadaiwmesklpdyeqakefaegvhav
ypeqklaynlspsfnwktamprdeqetyirrlaglgycwqfitlaglhttalisdrfara
ysevgmraygelvqepemelgvdvvkhqkwsgatyvdelqkmvt

SCOPe Domain Coordinates for d5e9ga_:

Click to download the PDB-style file with coordinates for d5e9ga_.
(The format of our PDB-style files is described here.)

Timeline for d5e9ga_: