Lineage for d1mjhb_ (1mjh B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312411Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 312525Family c.26.2.4: Universal stress protein-like [52436] (2 proteins)
  6. 312526Protein "Hypothetical" protein MJ0577 [52437] (1 species)
  7. 312527Species Archaeon Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry)
  8. 312529Domain d1mjhb_: 1mjh B: [31640]
    structural genomics
    complexed with atp, mn

Details for d1mjhb_

PDB Entry: 1mjh (more details), 1.7 Å

PDB Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics

SCOP Domain Sequences for d1mjhb_:

Sequence, based on SEQRES records: (download)

>d1mjhb_ c.26.2.4 (B:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl
nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd
iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns

Sequence, based on observed residues (ATOM records): (download)

>d1mjhb_ c.26.2.4 (B:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereiksveefenelknklt
eeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeil
lgsvtenvikksnkpvlvvkrkns

SCOP Domain Coordinates for d1mjhb_:

Click to download the PDB-style file with coordinates for d1mjhb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjhb_: