Lineage for d5av7b_ (5av7 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402563Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2402564Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2402593Protein Calystegia sepium agglutinin [101948] (1 species)
  7. 2402594Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (3 PDB entries)
  8. 2402602Domain d5av7b_: 5av7 B: [316390]
    automated match to d1ouwb_
    complexed with man, mma, nag

Details for d5av7b_

PDB Entry: 5av7 (more details), 1.85 Å

PDB Description: crystal structure of calsepa lectin in complex with bisected glycan
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d5av7b_:

Sequence, based on SEQRES records: (download)

>d5av7b_ b.77.3.1 (B:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
ssanvvgneivgflgrsgyyvdaigtynrh

Sequence, based on observed residues (ATOM records): (download)

>d5av7b_ b.77.3.1 (B:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
ssanvneivgflgrsgyyvdaigtynrh

SCOPe Domain Coordinates for d5av7b_:

Click to download the PDB-style file with coordinates for d5av7b_.
(The format of our PDB-style files is described here.)

Timeline for d5av7b_: