Lineage for d1mjha_ (1mjh A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 242351Family c.26.2.4: Universal stress protein-like [52436] (2 proteins)
  6. 242352Protein "Hypothetical" protein MJ0577 [52437] (1 species)
  7. 242353Species Archaeon Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry)
  8. 242354Domain d1mjha_: 1mjh A: [31639]

Details for d1mjha_

PDB Entry: 1mjh (more details), 1.7 Å

PDB Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics

SCOP Domain Sequences for d1mjha_:

Sequence, based on SEQRES records: (download)

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl
nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd
iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns

Sequence, based on observed residues (ATOM records): (download)

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikveefenelknklte
eaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeill
gsvtenvikksnkpvlvvkrkns

SCOP Domain Coordinates for d1mjha_:

Click to download the PDB-style file with coordinates for d1mjha_.
(The format of our PDB-style files is described here.)

Timeline for d1mjha_: