Lineage for d1mjha_ (1mjh A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178723Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 178724Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 178735Family c.29.1.2: Universal stress protein-like [52436] (2 proteins)
  6. 178736Protein "Hypothetical" protein MJ0577 [52437] (1 species)
  7. 178737Species Archaeon Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry)
  8. 178738Domain d1mjha_: 1mjh A: [31639]

Details for d1mjha_

PDB Entry: 1mjh (more details), 1.7 Å

PDB Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics

SCOP Domain Sequences for d1mjha_:

Sequence, based on SEQRES records: (download)

>d1mjha_ c.29.1.2 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl
nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd
iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns

Sequence, based on observed residues (ATOM records): (download)

>d1mjha_ c.29.1.2 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikveefenelknklte
eaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeill
gsvtenvikksnkpvlvvkrkns

SCOP Domain Coordinates for d1mjha_:

Click to download the PDB-style file with coordinates for d1mjha_.
(The format of our PDB-style files is described here.)

Timeline for d1mjha_: