Lineage for d3x0la_ (3x0l A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971452Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. 2971485Species Thermus thermophilus [TaxId:300852] [316338] (9 PDB entries)
  8. 2971487Domain d3x0la_: 3x0l A: [316389]
    automated match to d1v8ia_
    complexed with ar6
    has additional subdomain(s) that are not in the common domain

Details for d3x0la_

PDB Entry: 3x0l (more details), 1 Å

PDB Description: adp ribose pyrophosphatase from thermus thermophilus hb8 in es-state at 1.00 angstrom resolution
PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d3x0la_:

Sequence, based on SEQRES records: (download)

>d3x0la_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 300852]}
vertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagl
iepgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpded
eaievvwmrpeealerhqrgevefsatglvgvlyyhaflr

Sequence, based on observed residues (ATOM records): (download)

>d3x0la_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 300852]}
vertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagl
iepgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahedea
ievvwmrpeealerhqrgevefsatglvgvlyyhaflr

SCOPe Domain Coordinates for d3x0la_:

Click to download the PDB-style file with coordinates for d3x0la_.
(The format of our PDB-style files is described here.)

Timeline for d3x0la_: