Lineage for d1efpd_ (1efp D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1360010Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1360143Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 1360167Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 1360186Species Paracoccus denitrificans [TaxId:266] [81392] (1 PDB entry)
  8. 1360188Domain d1efpd_: 1efp D: [31638]
    Other proteins in same PDB: d1efpa1, d1efpa2, d1efpc1, d1efpc2
    complexed with amp, fad

Details for d1efpd_

PDB Entry: 1efp (more details), 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans
PDB Compounds: (D:) protein (electron transfer flavoprotein)

SCOPe Domain Sequences for d1efpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efpd_ c.26.2.3 (D:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]}
mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
elvgkl

SCOPe Domain Coordinates for d1efpd_:

Click to download the PDB-style file with coordinates for d1efpd_.
(The format of our PDB-style files is described here.)

Timeline for d1efpd_: