Lineage for d1efpd1 (1efp D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121268Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 121269Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 121270Family c.29.1.1: Electron transfer flavoprotein, ETFP [52432] (1 protein)
  6. 121271Protein Electron transfer flavoprotein, ETFP [52433] (2 species)
  7. 121275Species Paracoccus denitrificans [TaxId:266] [52435] (1 PDB entry)
  8. 121279Domain d1efpd1: 1efp D: [31638]
    Other proteins in same PDB: d1efpa2, d1efpc2

Details for d1efpd1

PDB Entry: 1efp (more details), 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans

SCOP Domain Sequences for d1efpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efpd1 c.29.1.1 (D:) Electron transfer flavoprotein, ETFP {Paracoccus denitrificans}
mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
elvgkl

SCOP Domain Coordinates for d1efpd1:

Click to download the PDB-style file with coordinates for d1efpd1.
(The format of our PDB-style files is described here.)

Timeline for d1efpd1: