Lineage for d4zhyb_ (4zhy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960712Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries)
  8. 2960724Domain d4zhyb_: 4zhy B: [316378]
    automated match to d4r40b_
    complexed with fmt, so4

Details for d4zhyb_

PDB Entry: 4zhy (more details), 1.97 Å

PDB Description: crystal structure of a bacterial signalling complex
PDB Compounds: (B:) YfiB

SCOPe Domain Sequences for d4zhyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhyb_ d.79.7.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
pgsmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtdnygdegynqklse
rraesvaavfreagmpaanievrglgmskpvadnktragrsenrrvaiivpa

SCOPe Domain Coordinates for d4zhyb_:

Click to download the PDB-style file with coordinates for d4zhyb_.
(The format of our PDB-style files is described here.)

Timeline for d4zhyb_: