Lineage for d1efpc1 (1efp C:2-184)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842395Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 1842396Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. 1842414Species Paracoccus denitrificans [TaxId:266] [81391] (1 PDB entry)
  8. 1842416Domain d1efpc1: 1efp C:2-184 [31637]
    Other proteins in same PDB: d1efpa2, d1efpb_, d1efpc2, d1efpd_
    complexed with amp, fad

Details for d1efpc1

PDB Entry: 1efp (more details), 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans
PDB Compounds: (C:) protein (electron transfer flavoprotein)

SCOPe Domain Sequences for d1efpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efpc1 c.26.2.3 (C:2-184) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}
avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
vae

SCOPe Domain Coordinates for d1efpc1:

Click to download the PDB-style file with coordinates for d1efpc1.
(The format of our PDB-style files is described here.)

Timeline for d1efpc1: