SCOPe 2.08: Domain d1efpc1: 1efp C:2-184

Lineage for d1efpc1 (1efp C:2-184)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
   contains an additional FAD-binding domain of DHS-like fold

7. Species Paracoccus denitrificans [TaxId:266] [81391] (1 PDB entry)

8. Domain d1efpc1: 1efp C:2-184 [31637]
   Other proteins in same PDB: d1efpa2, d1efpb_, d1efpc2, d1efpd_
   complexed with amp, fad

Details for d1efpc1

PDB Entry: 1efp, 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans

PDB Compounds: (C:) protein (electron transfer flavoprotein)

SCOPe Domain Sequences for d1efpc1:

Sequence; same for both SEQRES and ATOM records:

>d1efpc1 c.26.2.3 (C:2-184) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}
avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
vae

Timeline for d1efpc1:

• d1efpc1 first appeared (with stable ids) in SCOP 1.55
  
• d1efpc1 appears in SCOPe 2.07