Lineage for d4zc8a_ (4zc8 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439847Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2439848Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 protein domains)
    automatically mapped to Pfam PF00731
  6. 2439898Protein automated matches [191111] (3 species)
    not a true protein
  7. 2439899Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries)
  8. 2439908Domain d4zc8a_: 4zc8 A: [316369]
    automated match to d1u11b_
    complexed with act, edo, so4

Details for d4zc8a_

PDB Entry: 4zc8 (more details), 1.75 Å

PDB Description: structure of acetobacter aceti pure-s57t
PDB Compounds: (A:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d4zc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zc8a_ c.23.8.1 (A:) automated matches {Acetobacter aceti [TaxId: 1457393]}
apvvgiimgsqsdwetmrhadallteleiphetlivtahrtpdrladyartaaerglnvi
iagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasga
knaallaasilalynpalaarletwralqtasvpnspi

SCOPe Domain Coordinates for d4zc8a_:

Click to download the PDB-style file with coordinates for d4zc8a_.
(The format of our PDB-style files is described here.)

Timeline for d4zc8a_: