Lineage for d1efpb_ (1efp B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 242318Family c.26.2.3: ETFP subunits [52432] (2 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 242335Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 242348Species Paracoccus denitrificans [TaxId:266] [81392] (1 PDB entry)
  8. 242349Domain d1efpb_: 1efp B: [31636]
    Other proteins in same PDB: d1efpa1, d1efpa2, d1efpc1, d1efpc2

Details for d1efpb_

PDB Entry: 1efp (more details), 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans

SCOP Domain Sequences for d1efpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans}
mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
elvgkl

SCOP Domain Coordinates for d1efpb_:

Click to download the PDB-style file with coordinates for d1efpb_.
(The format of our PDB-style files is described here.)

Timeline for d1efpb_: